CD23, a 45kD Type II transmembrane glycoprotein, is a member of C-type Lectin family.
It is a human leukocyte differentiation antigen expressed in numerous hematopoietic lineage cells and consists of an extracellular lectin domain, alpha-helical coiled-coil stalk region, a transmembrane region and a cytoplasmic region.
It exists as 2 isoforms; CD23a is constitutively expressed in B-cells and expression of CD23b is induced by IL-4.
CD23 binds to CD21 antigen, CD11b, CD11c and also functions as a low-affinity receptor for human IgE (FcER2).
Role of CD23 include B-cell activation, differentiation, IgE synthesis, cell adhesion, regulating monocyte activation, antigen presentation and in the differentiation of early thymocytes.
Soluble fragment of CD23 promotes survival of germinal B-cell and increases histamine release from basophils.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MEEGQYSEIEELPRRRCCRRGTQIVLLGLVTAALWAGLLTLLLLWHWDTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS
Storage and Stability:Store product at 4°C in the dark.
DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid.
Dilute required amount only prior to immediate use.
Further dilutions can be made in assay buffer.
Caution: APC conjugates are sensitive to light.
For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
仕様
Size:100ul
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2, 0.09% sodium azide and a stabilizer. Labeled with Allophycocyanin (APC).
Specificity:Recognizes human FCER2.
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu
Immunogen:Full length human FCER2, aa1-321 (NP_001993.2).