84-2445-91　ANGPTL5 (Angiopoietin-related Protein 5, Angiopoietin-like Protein 5, UNQ5795/PRO19600) APC 100ul　123323-APC

特徴

• Angiopoietin-like 5 (ANGPTL5) is a secreted glycoprotein that is structurally related to the angiopoietins which contain an N-terminal coiled-coil domain and a C-terminal fibrinogen-like domain.
• It shares 88% and 93% aa sequence identity with bovine and porcine ANGPTL5, and greater than 98% identity with chimpanzee, orangutan, and rhesus ANGPTL5.
• ANGPTL5 is expressed in adipose, bronchial, epididymal, and heart tissue.
• Rare polymorphisms and loss of function mutations in human ANGPTL5 are associated with low circulating triglyceride levels and alterations in body mass index.
• ANGPTL5, when used in combination with other growth factors such as SCF, Thrombopoietin, IGF-II, FGF acidic, Flt-3 Ligand, and IGFBP-2, enhances the expansion and engraftment of human and mouse hematopoietic stem cells.
• The coiled-coil domain of ANGPTL proteins is critical for this effect.
• However, the molecular mechanism of ANGPTL proteins in stem cell activity remains unclear.
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• Amino Acid Sequence:MMSPSQASLLFLNVCIFICGEAVQGNCVHHSTDSSVVNIVEDGSNAKDESKSNDTVCKEDCEESCDVKTKITREEKHFMCRNLQNSIVSYTRSTKKLLRNMMDEQQASLDYLSNQVNELMNRVLLLTTEVFRKQLDPFPHRPVQSHGLDCTDIKDTIGSVTKTPSGLYIIHPEGSSYPFEVMCDMDYRGGGWTVIQKRIDGIIDFQRLWCDYLDGFGDLLGEFWLGLKKIFYIVNQKNTSFMLYVALESEDDTLAYASYDNFWLEDETRFFKMHLGRYSGNAGDAFRGLKKEDNQNAMPFSTSDVDNDGCRPACLVNGQSVKSCSHLHNKTGWWFNECGLANLNGIHHFSGKLLATGIQWGTWTKNNSPVKIKSVSMKIRRMYNPYFK
• Storage and Stability:Store product at 4°C in the dark.
• DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid.
• Dilute required amount only prior to immediate use.
• Further dilutions can be made in assay buffer.
• Caution: APC conjugates are sensitive to light.
• For maximum recovery of product, centrifuge the original vial prior to removing the cap.
• Note: Applications are based on unconjugated antibody.