84-2444-12　KCNE1 (Potassium Voltage-gated Channel Subfamily E Member 1, Delayed Rectifier Potassium Channel Subunit IsK, IKs Producing Slow Voltage-gated Potassium Channel Subunit beta Mink, ISK, Minimal Potassium Channel, MinK, Potassium Voltage-gated Channel Isk-related Family Member 1) APC 100ul　K0136-30A-APC

特徴

• The product of this gene belongs to the potassium channel KCNE family.
• Potassium ion channels are essential to many cellular functions and show a high degree of diversity, varying in their electrophysiologic and pharmacologic properties.
• This gene encodes a transmembrane protein known to associate with the product of the KVLQT1 gene to form the delayed rectifier potassium channel.
• Mutation in this gene are associated with both Jervell and Lange-Nielsen and Romano-Ward forms of long-QT syndrome.
• Alternatively spliced transcript variants encoding the same protein have been identified.
• Applications:Suitable for use in Western Blot.
• Other applications have not been tested.
• Recommended Dilutions:Optimal dilutions to be determined by the researcher.
• Amino Acid Sequence:MILSNTTAVTPFLTKLWQETVQQGGNMSGLARRSPRSSDGKLEALYVLMVLGFFGFFTLGIMLSYIRSKKLEHSNDPFNVYIESDAWQEKDKAYVQARVLESYRSCYVVENHLAIEQPNTHLPETKPSP
• Storage and Stability:Store product at 4°C in the dark.
• DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid.
• Dilute required amount only prior to immediate use.
• Further dilutions can be made in assay buffer.
• Caution: APC conjugates are sensitive to light.
• For maximum recovery of product, centrifuge the original vial prior to removing the cap.
• Note: Applications are based on unconjugated antibody.