84-2437-36　［取扱停止］Recoverin (Cancer-associated Retinopathy Protein, Protein CAR, RCVRN, RCV1) (AP) 100ul　132454-AP

特徴

• Recoverin belongs to a high-affinity calcium-binding family that includes neuronal calcium sensor-1, visinin-like proteins (VILIPs), guanylate cyclase-activating proteins (GCAPs), and Kv-channel interacting proteins (KchIPs).
• Features common to this family include four calcium-binding EF-hand domains, and an N-terminal myristoylation sequence.
• This family of proteins has been implicated in a broad range of cellular signaling functions, including phototransduction and neurotransmitter release, lipid metabolism, gene expression, and ion channel regulation.
• Myristoylation, the post-translational addition of a fatty acid tail, has been shown to have functional significance for other calcium-binding protein family members.
• Recoverin is subject to the posttranslational modification of myristoylation.
• Binding of calcium to recoverin elicits a change in conformation that exposes the buried hydrophobic myristoyl moiety to interaction with cell membranes and other cellular proteins.
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• AA Sequence:MGNSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKMKNA
• Storage and Stability:Store product at 4°C.
• DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid.
• Dilute required amount only prior to immediate use.
• Further dilutions can be made in assay buffer.
• For maximum recovery of product, centrifuge the original vial prior to removing the cap.
• Note: Applications are based on unconjugated antibody.