Leucine-rich repeat FLI-I interacting protein 1 (LRRFIP1/FLAP-1) is a MyD88-interacting signal protein which mediates either induction or repression of TLR signaling.
Flap-1 directly interacts with beta-catenin and activates beta-catenin-dependent transcription activity.
Flap-1 or LRRFIP1 was also shown to bind the TNF- -308 promoter polymorphism site, suggesting its possible role in the regulation of TNF- production.
FLAP-1 along with LRRFIP2 and FLIIH serve as a balance in coordinating inflammatory response after infection, and may act as a novel target in the control of agonist-induced TLR-mediated inflammatory and autoimmune diseases.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MHVMDLQRDANRQISDLKFKLAKSEQEITALEQNVIRLESQVSRYKSAAENAEKIEDELKAEKRKLQRELRSALDKTEELEVSNGHLVKRLEKMKANRSALLSQQ
Storage and Stability:Store product at 4°C.
DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid.
Dilute required amount only prior to immediate use.
Further dilutions can be made in assay buffer.
For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
仕様
Size：100ul
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by Protein A affinity chromatography.
Form：Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phophatase (AP).
Specificity：Recognizes human LRRFIP1. Species Crossreactivity: mouse.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu Mo
Immunogen：Full length human LRRFIP1, aa1-105 (AAH10662.1)
