KIR2DL5 is the most recently identified human killer cell immunoglobulin-like receptors (KIR), which are transmembrane glycoproteins expressed by natural killer cells (NK) and subsets of T cells.
KIR2DL5 is a type II member of the KIR2D family with two extracellular Ig-like domains of the D0 and D2 type.
Its structure is expressed by 50% of humans and is conserved among primate species.
Its gene localized on human chromosome 19p13.3, is restricted to the B subset of KIR haplotypes.
The protein is represented in the human genome by two genes, KIR2DL5A and KIR2DL5B that show 99.5-99.7% identity in their coding sequences.
The protein acts as a receptor on NK cells for HLA-C alleles, inhibits the activity of NK cell and thus plays a specialized role in innate immunity.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MSLMVISMACVGFFLLQGAWTHEGGQDKPLLSAWPSAVVPRGGHVTLLCRSRLGFTIFSLYKEDGVPVPELYNKIFWKSILMGPVTPAHAGTYRCRGSHPRSPIEWSAPSNPLVIVVTGLFGKPSLSAQPGPTVRTGENVTLSCSSRSSFDMYHLSREGRAHEPRLPAVPSVNGTFQADFPLGPATHGGTYTCFGSLHDSPYEWSDPSDPLLVSVTGNSSSSSSSPTEPSSKTGIRRHLHILIGTSVAIILFIILFFFLLHCCCSNKKNAAVMDQEPAGDRTVNREDSDDQDPQEVTYAQLDHCVFTQTKITSPSQRPKTPPTDTTMYMELPNAKPRSLSPAHKHHSQALRGSSRETTALSQNRVASSHVPAAGI
Storage and Stability:Store product at 4°C.
DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid.
Dilute required amount only prior to immediate use.
Further dilutions can be made in assay buffer.
For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
仕様
Size:100ul
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phophatase (AP).
Specificity:Recognizes human KIR2DL5A.
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu
Immunogen:Full length human KIR2DL5A, aa1-375 (AAI60063.1).