84-2428-39　［取扱停止］IL10 (CSIF, IL-10, IL10A, MGC126450, MGC126451, TGIF) (AP) 100ul　128378-AP

特徴

• The protein is a cytokine produced primarily by monocytes and to a lesser extent by lymphocytes.
• This cytokine has pleiotropic effects in immunoregulation and inflammation.
• It down-regulates the expression of Th1 cytokines, MHC class II Ags, and costimulatory molecules on macrophages.
• It also enhances B cell survival, proliferation, and antibody production.
• This cytokine can block NF-kappa B activity, and is involved in the regulation of the JAK-STAT signaling pathway.
• Knockout studies in mice suggested the function of this cytokine as an essential immunoregulator in the intestinal tract.
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• Amino Acid Sequence:MHSSALLCCLVLLTGVRASPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN
• Storage and Stability:Store product at 4°C.
• DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid.
• Dilute required amount only prior to immediate use.
• Further dilutions can be made in assay buffer.
• For maximum recovery of product, centrifuge the original vial prior to removing the cap.
• Note: Applications are based on unconjugated antibody.