Folate receptor 1 (FOLR1; also folate receptor alpha, folate binding protein 1, and MOv18) is a 37-42kD member of the folate receptor family.
FOLR1 is expressed in reticulocytes and placenta, plus renal, mammary, and thymic epithelium, where it mediates the transport of 5-methyltetrahydrofolate into the cell.
The human FOLR1 preproprecursor is 257aa in length.
It codes for a GPI-linked glycoprotein that is 210aa in size (aa25-234).
There are two forms of FOLR1.
One is GPI-linked, while the other is a soluble MMP cleavage product (aa25-226).
There is one potential alternate splice form that shows a five aa substitution for aa121-205.
Over aa25-233, human FOLR1 shares 83% aa identity with mouse FOLR1.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWAAWPFLLSLALMLLWLLS
Storage and Stability:Store product at 4°C.
DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid.
Dilute required amount only prior to immediate use.
Further dilutions can be made in assay buffer.
For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
仕様
Size:100ul
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phophatase (AP).
Specificity:Recognizes human FOLR1.
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu
Immunogen:Full length human FOLR1, aa1-257 (NP_000793.1).