84-2422-53　［取扱停止］DIAPH1 (Protein Diaphanous Homolog 1, Diaphanous-related Formin-1, DRF1, DIAP1) (AP) 100ul　125840-AP

特徴

• Acts in a Rho-dependent manner to recruit PFY1 to the membrane.
• Required for the assembly of F-actin structures, such as actin cables and stress fibers.
• Nucleates actin filaments.
• Binds to the barbed end of the actin filament and slows down actin polymerization and depolymerization.
• Required for cytokinesis, and transcriptional activation of the serum response factor.
• DFR proteins couple Rho and Src tyrosine kinase during signaling and the regulation of actin dynamics.
• Functions as a scaffold protein for MAPRE1 and APC to stabilize microtubules and promote cell migration (By similarity).
• Has neurite outgrowth promoting activity (By similarity).
• In hear cells, it may play a role in the regulation of actin polymerization in hair cells.
• The MEMO1-RHOA-DIAPH1 signaling pathway plays an important role in ERBB2-dependent stabilization of microtubules at the cell cortex.
• It controls the localization of APC and CLASP2 to the cell membrane, via the regulation of GSK3B activity.
• In turn, membrane-bound APC allows the localization of the MACF1 to the cell membrane, which is required for microtubule capture and stabilization.
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• Amino Acid Sequence: MPYQEIKNVILEVNEAVLTESMIQNLIKQMPEPEQLKMLSELKDEYDDLAESEQFGVVMGTVPRLRPRLNAILFKLQFSEQVENIKPEIVSVTAACEELRKSESFSNLLEITLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSTDQKMTLLHFLAELCENDYPDVLKFPDELAHVEKASRVSAENLQKNLDQMKKQISDVERDVQNFPAATDEKDKFVEKMTSFVKDAQEQYNKLRMMHSNMETLYKELGEYFLFDPKKLSVEEFFMDLHNFRNMFLQAVKENQKRRETEEKMRRAKLAKEKAEKERLEKQQKREQLIDMNAEGDETGVMDSLLEALQSGAAFRRKRGPRQANRKAGCAVTSLLASELTKDDAMAAVPAKVSKNSETFPTILEEAKELVGRAS
• Storage and Stability:Store product at 4°C.
• DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid.
• Dilute required amount only prior to immediate use.
• Further dilutions can be made in assay buffer.
• For maximum recovery of product, centrifuge the original vial prior to removing the cap.
• Note: Applications are based on unconjugated antibody.