84-2420-49　［取扱停止］Chromogranin A (CGA, CHG A, Pancreastatin, Parathyroid Secretory Protein 1, Pituitary Secretory Protein I, Vasostatin, SPI) (AP) 100ul　124982-AP

特徴

• The prohormone chromogranin A (CgA) is a member of the chromogranin:secretogranin protein family of regulated secretory proteins, which are widely distributed in secretory granules of endocrine, neuroendocrine, and neuronal cells.
• It is required for the formation of dense-core secretory granules and hormone sequestration in sympathoadrenal chromaffin cells.
• It functions as prohormones, giving rise to bioactive peptides, vasostatin, pancreastatin, and parastatin as a result of post-translational proteolytic processing.
• Peptides derived from chromogranin A have autocrine, paracrine, and endocrine activities.
• It also inhibit secretion of proopiomelanocortin hormone.
• Catestatin, another fragment of chromogranin A, inhibits the release of catecholamines from sympathoadrenal chromaffin cells by blocking the neuronal nicotinic cholinergic receptor, which is the physiologic trigger for secretion.
• Other peptides, including chromostatin, beta-granin, WE-14 and GE-25, are also derived from the full-length protein.
• It maps to 14q32 region of human chromosome.
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• AA Sequence:MDYYRKYAAIFLVTLSVFLHVLHSAPDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
• Storage and Stability:Store product at 4°C.
• DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid.
• Dilute required amount only prior to immediate use.
• Further dilutions can be made in assay buffer.
• For maximum recovery of product, centrifuge the original vial prior to removing the cap.
• Note: Applications are based on unconjugated antibody.