CCAAT-enhancer binding protein epsilon (CEBP e) is a 32kD basic-leucine zipper transcription factor that is expressed in myeloblasts, granulocytes, and eosinophils.
Multiple isoforms of human CEBP e are generated by alternate splicing and alternative translation initiation sites.
All four isoforms contain the bZIP domain (aa208-267) but exert different effects on myeloid differentiation.
Full length CEBP e and the 30kD isoform (aa33-281) cooperate with c-Myb to activate the transcription of genes involved in myeloid differentiation.
The 27kD isoform (which lacks aa69-97) and the 14kD isoform (which begins at aa153) function as transcriptional repressors in eosinophils.
Within aa151-210, human CEBP e shares 93aa sequence identity with mouse and rat CEBP e, respectively.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MSHGTYYECEPRGGQQPLEFSGGRAGPGELGDMCEHEASIDLSAYIESGEEQLLSDLFAVKPAPEARGLKGPGTPAFPHYLPPDPRPFAYPPHTFGPDRKALGPGIYSSPGSYDPRAVAVKEEPRGPEGSRAASRGSYNPLQYQVAHCGQTAMHLPPTLAAPGQPLRVLKAPLATAAPPCSPLLKAPSPAGPLHKGKKAVNKDSLEYRLRRERNNIAVRKSRDKAKRRILETQQKVLEYMAENERLRSRVEQLTQELDTLRNLFRQIPEAANLIKGVGGCS
Storage and Stability:Store product at 4°C.
DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid.
Dilute required amount only prior to immediate use.
Further dilutions can be made in assay buffer.
For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
仕様
Size：100ul
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by Protein A affinity chromatography.
Form：Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phophatase (AP).
Specificity：Recognizes human CEBPE. Species Crossreactivity: mouse.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu Mo
Immunogen：Full length human CEBPE, aa1-281 (NP_001796.2).
