CD58, or LFA-3, is a membrane glycoprotein of 55-70kD.
It occurs in two forms, one transmembrane with a cytoplasmic domain, the other form anchored in the membrane via a glycosylphosphatidylinositol tail.
The complete amino acid sequence of both forms has been deduced from cDNA.
It is heavily N-glycosylated.
CD58 is a cell adhesion molecule which plays a critical role in facilitation of antigen specific recognition through interaction with CD2 on T lymphocytes.
It is a member of the immunoglobulin superfamily of molecules.CD58 has a wide tissue distribution, being present on erythrocytes, platelets, monocytes, a subset of lymphocytes, bone marrow cells, epithelium and endothelial cells[2].
There are approximately 5,000 CD58 molecules on each erythrocyte.
There is reduced expression of CD58 on haemopoietic cells in individuals with paroxysmal nocturnal haemoglobinuria.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MVAGSDAGRALGVLSVVCLLHCFGFISCFSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEHYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHRYALIPIPLAVITTCIVLYMNGILKCDRKPDRTNSN
Storage and Stability:Store product at 4°C.
DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid.
Dilute required amount only prior to immediate use.
Further dilutions can be made in assay buffer.
For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
仕様
Size:100ul
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phophatase (AP).
Specificity:Recognizes human CD58.
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu
Immunogen:Full length human CD58, aa1-250 (NP_001770.1).