CD23, a 45kD Type II transmembrane glycoprotein, is a member of C-type Lectin family.
It is a human leukocyte differentiation antigen expressed in numerous hematopoietic lineage cells and consists of an extracellular lectin domain, alpha-helical coiled-coil stalk region, a transmembrane region and a cytoplasmic region.
It exists as 2 isoforms; CD23a is constitutively expressed in B-cells and expression of CD23b is induced by IL-4.
CD23 binds to CD21 antigen, CD11b, CD11c and also functions as a low-affinity receptor for human IgE (FcER2).
Role of CD23 include B-cell activation, differentiation, IgE synthesis, cell adhesion, regulating monocyte activation, antigen presentation and in the differentiation of early thymocytes.
Soluble fragment of CD23 promotes survival of germinal B-cell and increases histamine release from basophils.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MEEGQYSEIEELPRRRCCRRGTQIVLLGLVTAALWAGLLTLLLLWHWDTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS
Storage and Stability:Store product at 4°C.
DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid.
Dilute required amount only prior to immediate use.
Further dilutions can be made in assay buffer.
For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
仕様
Size:100ul
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phophatase (AP).
Specificity:Recognizes human FCER2.
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu
Immunogen:Full length human FCER2, aa1-321 (NP_001993.2).