B cell-activating factor receptor (BAFF-R) is a 19kD type III membrane protein.
It belongs to the TNFR superfamily also known as TNFRSF member 13C (TNFRSF13C), BAFF receptor 3 (BR3), or CD268.
BAFF-R is expressed on mature B cells, B cell lymphoma, and T cell subset.
BAFF-R is the major receptor for BAFF/BLys (or TALL-1, THANK), which binds to TACI and BCMA as well.
The interaction of BAFF with BAFF-R promotes NF-k B activation and plays a major role in B-cell maturation and survival, as well as costimulates T cell activation and proliferation.
TRAF3 is a BAFF-R intracellularly associated protein, which negatively regulates BAFF-R-mediated NF-k B activation.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPGLLFGAPALLGLALVLALVLVGLVSWRRRQRRLRGASSAEAPDGDKDAPEPLDKVIILSPGISDATAPAWPPPGEDPGTTPPGHSVPVPATELGSTELVTTKTAGPEQQ
Storage and Stability:Store product at 4°C.
DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid.
Dilute required amount only prior to immediate use.
Further dilutions can be made in assay buffer.
For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
仕様
Size：100ul
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by Protein A affinity chromatography.
Form：Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phophatase (AP).
Specificity：Recognizes human BAFF Receptor. Species Crossreactivity: mouse
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu Mo
Immunogen：Full length protein corresponding to aa 1-184 from human BAFF Receptor.
