84-2416-23　［取扱停止］AKR1C2 (Aldo-keto Reductase Family 1 Member C2, 3-alpha-HSD3, Chlordecone Reductase Homolog HAKRD, Dihydrodiol Dehydrogenase 2, DD-2, DD2, Dihydrodiol Dehydrogenase/Bile Acid-binding Protein, DD/BABP, Trans-1,2-dihydrobenzene-1,2-diol Dehydrogenase, Type III 3-alpha-hydroxysteroid Dehydrogenase, DDH2) (AP) 100ul　123161-AP

特徴

• AKR1C2 is a member of the aldo-oxo reductase (AKR) superfamily.
• It catalyzes the NADP-linked oxidation of trans-dihydrodiols of aromatic hydrocarbons to corresponding catechols.
• AKR1C2 works in concert with the 5-alpha/5-beta-steroid reductases to convert steroid hormones into the 3-alpha/5-alpha and 3-alpha/5-beta-tetrahydrosteroids.
• It catalyzes the inactivation of the most potent androgen 5-alpha-dihydrotestosterone (5-alpha-DHT) to 5-alpha-androstane-3-alpha,17-beta-diol (3-alpha-diol).
• AKR1C2 has a high bile-binding ability.
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• Amino Acid Sequence:MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY
• Storage and Stability:Store product at 4°C.
• DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid.
• Dilute required amount only prior to immediate use.
• Further dilutions can be made in assay buffer.
• For maximum recovery of product, centrifuge the original vial prior to removing the cap.
• Note: Applications are based on unconjugated antibody.