a1-Acid Glycoprotein (AGP; also OMD/Orosomucoid) is a 40-46kD member of the immunocalin subfamily, lipocalin family of molecules.
In mouse, circulating AGP is principally the product of hepatocytes that originates from multiple related genes (AGP-1, -2 and -3 in Mus musculus).
Circulating AGP-1 and -2 are both 189aa in length, the principal sources of protein, and show 83% aa identity; AGP-3 contributes little to the AGP pool.
In mouse blood, AGP is normally 200-400ug/ml.
In response to inflammatory mediators (IL-6; IL-1), its concentration will rise 2-10 fold.
More importantly, a complex glycosylation pattern will also change, transitioning from modestly branched to highly branched oligosaccharides.
This change is reflected in its bioactivity, which has been shown to be a function of carbohydrate branching.
AGP is generally considered to be a suppressor of inflammation.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MALSWVLTVLSLLPLLEAQIPLCANLVPVPITNATLDQITGKWFYIASAFRNEEYNKSVQEIQATFFYFTPNKTEDTIFLREYQTRQDQCIYNTTYLNVQRENGTISRYVGGQEHFAHLLILRDTKTYMLAFDVNDEKNWGLSVYADKPETTKEQLGEFYEALDCLRIPKSDVVYTDWKKDKCEPLEKQHEKERKQEEGES
Storage and Stability:Store product at 4°C.
DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid.
Dilute required amount only prior to immediate use.
Further dilutions can be made in assay buffer.
For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
仕様
Size：100ul
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by Protein A affinity chromatography.
Form：Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phophatase (AP).
Specificity：Recognizes human ORM1.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu
Immunogen：Full length human ORM1, aa1-201 (NP_000598.1).
