(formalin fixed/paraffin embedded tissues, 4% paraformaldehyde fixed frozen tissues)Optimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized powder may be stored at -20°C.
Stable for 12 months after receipt at -20°C.
Reconstitute with PBS.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Reconstituted product is stable for 12 months at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size:50ug
Host:rabbit
Source Antibody:human
Grade:Purified
Purity:Purified
Form:Supplied as a lyophilized powder in BSA. Reconstitute with 500ul PBS, pH 7.4.
Specificity:Recognizes human Beta Endorphin. Species Crossreactivity: Rat, mouse. Cross-reactivity with other opioid peptides is as follows: Met-enkephalin 0.03%; Leu-enkephalin 0.02%; beta-lipotropin 0.34%.
Isotype:IgG
Calc Applications Abbrev:IF IHC RIA
Calc Crossreactivity:Hu Mo Rt
Immunogen:Synthetic human beta-endorphin peptide corresponding to aa1-31, conjugated to BSA. Sequence: YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE