Neuregulin 1 (NRG1) was originally identified as a 44kD glycoprotein that interacts with the NEU/ERBB2 receptor tyrosine kinase to increase its phosphorylation on tyrosine residues.
It is known that an extraordinary variety of different isoforms are produced from the NRG1 gene by alternative splicing.
These isoforms include heregulins (HRGs), glial growth factors (GGFs) and sensory and motor neuron-derived factor (SMDF).
They are tissue-specifically expressed and differ significantly in their structure.
The HRG isoforms all contain immunoglobulin (Ig) and epidermal growth factor-like (EGF-like) domains.
GGF and GGF2 isoforms contain a kringle-like sequence plus Ig and EGF-like domains; and the SMDF isoform shares only the EGF-like domain with other isoforms.
The receptors for all NRG1 isoforms are the ERBB family of tyrosine kinase transmembrane receptors.
Through interaction with ERBB receptors, NRG1 isoforms induce the growth and differentiation of epithelial, neuronal, glial, and other types of cells.
Applications:Suitable for use in ELISA, Western Blot, Immunohistochemistry and Neutralization.
Other applications not tested.
Recommended Dilution:Immunohistochemistry (FFPE): Heat induced antigen retrieval with a pH 6.0 sodium citrate buffer is recommended.
Optimal dilutions to be determined by the researcher.
Storage and Stability:Store product at 4°C if to be used immediately within two weeks.
For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C.
Aliquots are stable at -20°C for 12 months after receipt.
Dilute required amount only prior to immediate use.
Further dilutions can be made in assay buffer.
Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.
仕様
Size:100ul
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by immunoaffinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Specificity:Recognizes human Heregulin beta-1.
Isotype:IgG
Calc Applications Abbrev:E IHC N WB
Calc Crossreactivity:Hu
Immunogen:EGF domain of human Heregulin beta-1.Amino Acid Sequence: SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFY KHLGIEFMEAE