SLC26A5 is a member of the SLC26A/SulP transporter family.
SLC26A5 is specifically expressed in outer hair cells (OHCs) of the cochlea and is essential in auditory processing.
Intracellular anions are thought to act as extrinsic voltage sensors, which bind to this protein and trigger the conformational changes required for rapid length changes in OHCs.
Mutations in its gene have been associated with non-syndromic hearing loss.
Applications:Suitable for use in Western Blot and Immunohistochemistry.
Other applications not tested.
Recommended Dilution:Western Blot: 2.5ug/mlImmunohistochemistry: 4-8ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized powder may be stored at -20°C.
Stable for 12 months at -20°C.
Reconstitute with sterile dH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Reconstituted product is stable for 12 months at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by Protein A affinity chromatography.
Form：Supplied as a lyophilized powder in PBS. Reconstitute with 100ul dH2O to 1mg/ml.
Specificity：Recognizes SLC26A5. Species Crossreactivity: Human, mouse, rat and canine.
Isotype：IgG
Calc Applications Abbrev：IHC WB
Calc Crossreactivity：Ca Hu Mo Rt
Immunogen：Synthetic peptide corresponding to FSVTISMAKTLANKHGYQVDGNQELIALGLCNSIGSLFQTFSISCSLSRS
