SLC16A8 is proton-linked monocarboxylate transporter.
It catalyzes the rapid transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, and the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate.
Applications:Suitable for use in Western Blot and Immunohistochemistry.
Other applications not tested.
Recommended Dilution:Western Blot: 2.5ug/mlImmunohistochemistry: 4-8ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C.
Reconstitute with sterile ddH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by Protein A affinity chromatography.
Form：Supplied as a lyophilized powder from PBS, 2% sucrose. Reconstitute with 100ul sterile ddH2O.
Specificity：Recognizes human SLC16A8. Species crossreactivity: mouse, rat canine, zebrafish, bovine, guinea pig, equine, rabbit
Isotype：IgG
Calc Applications Abbrev：IHC WB
Calc Crossreactivity：Bo Ca Eq Gp Hu Mo Rb Rt
Immunogen：Synthetic peptide corresponding to aa RAFAVYAVTKFLMALGLFVPAILLVNYAKDAGVPDTDAAFLLSIVGFVDI from the middle region of human SLC16A8.
