Epidermal growth factor like repeats are a class of cysteine-rich domains that mediate interactions between proteins of diverse function.
EGF domains are found in proteins that are either completely secreted or have transmembrane regions that tether the protein to the cell surface.
CRELD1 is the founding member of a family of matricellular proteins.
Applications:Suitable for use in Western Blot and Immunohistochemistry.
Other applications not tested.
Recommended Dilution:Western Blot: 5ug/mlImmunohistochemistry (paraffin): 4-8ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months after receipt.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：100ul
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by Protein A affinity chromatography.
Form：Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.
Specificity：Recognizes human CRELD1.
Isotype：IgG
Calc Applications Abbrev：IHC WB
Calc Crossreactivity：Hu
Immunogen：Synthetic peptide located within the following region: TEVCPGENKQCENTEGGYRCICAEGYKQMEGICVKEQIPESAGFFSEMTE corresponding to the C-terminal region of human CRELD1. Species sequence homology: bovine, canine, guinea pig, equine, mouse and rat
