Heat induced antigen retrieval is required Optimal dilutions to be determined by the researcher.
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months after receipt.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：250ul
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by affinity chromatography.
Form：Supplied as a liquid in TBS pH 7.4, 0.1% BSA, 0.02% sodium azide, 50% glycerol.
Specificity：Recognizes human EP4. Does not cross react with EP1, EP2 or EP3 receptors.
Isotype：IgG
Calc Applications Abbrev：IC IHC WB
Calc Crossreactivity：Hu
Immunogen：Synthetic peptide corresponding to aa459-488, (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI) at the C-Terminal of human EP4. Species Sequence Homology: monkey, bovine and rabbit.
