84-1407-80 ZNHIT1 (Zinc Finger HIT Domain-containing Protein 1, Cyclin-G1-binding Protein 1, CGBP1, p18 Hamlet, Zinc Finger Protein Subfamily 4A Member 1, ZNFN4A1) 50ug 135816
84-1407-80 ZNHIT1 (Zinc Finger HIT Domain-containing Protein 1, Cyclin-G1-binding Protein 1, CGBP1, p18 Hamlet, Zinc Finger Protein Subfamily 4A Member 1, ZNFN4A1) 50ug 135816
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MVEKKTSVRSQDPGQRRVLDRAARQRRINRQLEALENDNFQDDPHAGLPQLGKRLPQFDDDADTGKKKKKTRGDHFKLRFRKNFQALLEEQNLSVAEGPNYLTACAGPPSRPQRPFCAVCGFPSPYTCVSCGARYCTVRCLGTHQETRCLKWTV
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for at least 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:50ug
Host:mouse
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2.
Specificity:Recognizes human ZNHIT1.
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu
Immunogen:Full-length human ZNHIT1, aa1-154 (NP_006340.1).