84-1407-23 ZNF434 (Zinc Finger Protein 434, Human Cervical Cancer Suppressor Gene 5 Protein, HCCS5, HCCS-5, Zinc Finger and SCAN Domain-containing Protein 32, ZSCAN32) 50ug 135732
84-1407-23 ZNF434 (Zinc Finger Protein 434, Human Cervical Cancer Suppressor Gene 5 Protein, HCCS5, HCCS-5, Zinc Finger and SCAN Domain-containing Protein 32, ZSCAN32) 50ug 135732
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MAAVKSTEAHPSSNKDPTQGQKSALQGNSPDSGASRQRFRQFCYQEVTGPHEAFSKLWELCCQWLRPKTHSKEEILELLVLEQFLTILPEEIQTWVREQHPENGEEAVALVEDVQRAPGQQVLDSEKDLKVLMKEMAPLGATRESLRSQWKQEVQPEEPTFKGSQSSHQRPGEQSEAWLAPQAPRNLPQNTGLHDQETGAVVWTAGSQGPAMRDNRAVSLCQQEWMCPGPAQRALYRGATQRKDSHVSLATGALGL*
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for at least 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:50ug
Host:mouse
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2.
Specificity:Recognizes human ZNF434.
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu
Immunogen:Full length human ZNF434, aa1-257 (AAH02859).