84-1405-76　YBX1 (NSEP1, YB1, Nuclease-sensitive Element-binding Protein 1, CCAAT-binding Transcription Factor I Subunit A, DNA-binding Protein B, Enhancer Factor I Subunit A, Y-box Transcription Factor, Y-box-binding Protein 1, MGC104858, MGC110976, MGC117250) 100ul　135475

特徴

• Mediates pre-mRNA alternative splicing regulation.
• Binds to splice sites in pre-mRNA and regulates splice site selection.
• Binds and stabilizes cytoplasmic mRNA.
• Contributes to the regulation of translation by modulating the interaction between the mRNA and eukaryotic initiation factors (By similarity).
• Binds to promoters that contain a Y-box (5'-CTGATTGGCCAA-3'), such as HLA class II genes.
• Regulates the transcription of numerous genes.
• Promotes separation of DNA strands that contain mismatches or are modified by cisplatin.
• Has endonucleolytic activity and can introduce nicks or breaks into double-stranded DNA (in vitro).
• May play a role in DNA repair.
• Component of the CRD-mediated complex that promotes MYC mRNA stability.
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• AA Sequence:MSSEAETQQPPAAPPAAPALSAADTKPGTTGSGAGSGGPGGLTSAAPAGGDKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAADRNHYRRYPRRRGPPRNYQQNYQNSESGEKNEGSESAPEGQAQQRRPYRRRRFPPYYMRRPYGRRPQYSNPPVQGEVMEGADNQGAGEQGRPVRQNMYRGYRPRFRRGPPRQRQPREDGNEEDKENQGDETQGQQPPQRRYRRNFNYRRRRPENPKPQDGKETKAADPPAENSSAPEAEQGGAE
• Storage and Stability:May be stored at 4°C for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20°C.
• Aliquots are stable for at least 12 months.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.