84-1403-96 VAPA (Vesicle-associated Membrane Protein-associated Protein A, VAMP-associated Protein A, VAMP-A, VAP-A, 33kD VAMP-associated Protein, VAP33, VAP-33, hVAP-33) 50ug 135202
84-1403-96 VAPA (Vesicle-associated Membrane Protein-associated Protein A, VAMP-associated Protein A, VAMP-A, VAP-A, 33kD VAMP-associated Protein, VAP33, VAP-33, hVAP-33) 50ug 135202
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MAKHEQILVLDPPTDLKFKGPFTDVVTTNLKLRNPSDRKVCFKVKTTAPRRYCVRPNSGIIDPGSTVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNTSDMEAVWKEAKPDELMDSKLRCVFEMPNENDKLNDMEPSKAVPLNASKQDGPMPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSTASFRDNVTSPLPSLLVVIAAIFIGFFLGKFIL
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:50ug
Host:mouse
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2.
Specificity:Recognizes human VAPA.
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu
Immunogen:Full length human VAPA, aa1-242 (ENSP00000217602)