TSC22 domain family protein, or TSC22, is a transcription factor that belongs to the large family of early response genes.
This transcriptional repressor is known to act on the C-type natriuretic peptide (CNP) promoter.
TSC22 belongs to the TSC-22:Dip:Bun family and is an intracellular protein that may be found in the cytoplasm or nucleus.
This transcription factor is known to regulate cell growth, differentiation and cell death and is involved in modulating the transcriptional activity of Smad3 and Smad4.
This protein is ubiquitously expressed in most tissues and widely in both fetal and adult tissues.
It is generally expressed in aortic endothelial cells, and induced by cytokines, including TGFB.
These proteins may be possible therapeutic targets of leukemia and prostate cancer.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MKSQWCRPVAMDLGVYQLRHFSISFLSSLLGTENASVRLDNSSSGASVVAIDNKIEQAMDLVKSHLMYAVREEVEVLKEQIKELIEKNSQLEQENNLLKTLASPEQLAQFQAQLQTGSPPATTQPQGTTQPPAQPASQGSGPTA
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:100ug
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2.
Specificity:Recognizes human TSC22D1.
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu
Immunogen:Full length human TSC22D1, aa1-144 (NP_006013.1).