Sentrin-2 also known as SUMO-3 is a novel ubiquitin-like protein that can be conjugated to other proteins in a manner analogous to ubiquitination.
It is a 95aa peptide that is 46% identical and 66% homologous to sentrin-1.
Sentrin interacts with the death domains of Fas, TNFR1 (tumor necrosis factor receptor 1), PML (a tumor suppressor), Rad51 and Rad 52, which are involved in repairing dsDNA breaks, and with GAP1.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for at least 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by Protein A affinity chromatography.
Form：Supplied as a liquid in PBS, pH 7.2.
Specificity：Recognizes human SUMO2.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu
Immunogen：Full length human SUMO2, aa1-95 (NP_008868.3).
