84-1395-82 SPLC2 (BPIFA2, C20orf70, SPLUNC2, BPI Fold-containing Family A Member 2, Parotid Secretory Protein, Short Palate, Lung and Nasal Epithelium Carcinoma-associated Protein 2) 50ug 133779
84-1395-82 SPLC2 (BPIFA2, C20orf70, SPLUNC2, BPI Fold-containing Family A Member 2, Parotid Secretory Protein, Short Palate, Lung and Nasal Epithelium Carcinoma-associated Protein 2) 50ug 133779
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MLQLWKLVLLCGVLTGTSESLLDNLGNDLSNVVDKLEPVLHEGLETVDNTLKGILEKLKVDLGVLQKSSAWQLAKQKAQEAEKLLNNVISKLLPTNTDIFGLKISNSLILDVKAEPIDDGKGLNLSFPVTANVTVAGPIIGQIINLKASLDLLTAVTIETDPQTHQPVAVLGECASDPTSISLSLLDKHSQIINKFVNSVINTLKSTVSSLLQKEICPLIRIFIHSLDVNVIQQVVDNPQHKTQLQTLI
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for at least 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:50ug
Host:mouse
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2.
Specificity:Recognizes human C20orf70.
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu
Immunogen:Full length human C20orf70, aa1-249 (NP_542141).