84-1394-86　SNAI2 (Zinc Finger Protein SNAI2, Neural Crest Transcription Factor Slug, Protein Snail Homolog 2, SLUG, SLUGH, MGC10182) 100ul　133599

特徴

• This gene encodes a member of the Snail family of C2H2-type zinc finger transcription factors.
• The encoded protein acts as a transcriptional repressor that binds to E-box motifs and is also likely to repress E-cadherin transcription in breast carcinoma.
• This protein is involved in epithelial-mesenchymal transitions and has antiapoptotic activity.The tumor suppressor protein p53 induces Slug expression in γ-irradiated cells; Slug protects damaged cells from apoptosis by repressing p53-induced transcription of the proapoptotic Bcl-2 family protein Puma.
• Mutations in this gene may be associated with sporatic cases of neural tube defects.
• Applications:Suitable for use in Immunoprecipitation.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• AA Sequence:MPRSFLVKKHFNASKKPNYSELDTHTVIISPYLYESYSMPVIPQPEILSSGAYSPITVWTTAAPFHAQLPNGLSPLSGYSSSLGRVSPPPPSDTSSKDHSGSESPISDEEERLQSKLSDPHAIEAEKFQCNLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEYVSLGALKMHIRTHTLPCVCKICGKAFSRPWLLQGHIRTHTGEKPFSCPHCNRAFADRSNLRAHLQTHSDVKKYQCKNCSKTFSRMSLLHKHEESGCCVAH
• Storage and Stability:May be stored at 4°C for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20°C.
• Aliquots are stable for at least 12 months.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.