SMAD3, a transcriptional regulator, is activated by TGF-beta and Activin 1 receptor kinase.
SMAD3 recognizes an 8 bp palindromic sequence GTCTAGAC.
Upon phosphorylation at two extreme C-terminal serines, SMAD3 is translocated into the nucleus where is forms complexes other SMAD proteins, depending on the activation pathway, and regulates the transcription of target genes.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:ELRLHHSFVLTGDVGRRICRLLVGLFTKGDTSSKRVHPFSPGPCFLLCDLARVGSSPKINVSPFYQNQTSTQRSCTVFVWQRCSLVGPFQVTVFTMYFHHSLRSISRFSSG
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for at least 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by Protein A affinity chromatography.
