84-1394-50　SMAC (Diablo Homolog, Mitochondrial, Second Mitochondria-derived Activator Of Caspase, Smac, Direct IAP-binding Protein With Low pI, DIABLO, FLJ10537, FLJ25049) 100ug　133533

特徴

• Second mitochondria-derived activator of caspase (SMAC) has been implicated in the activation of apoptosis in response to cell stress.
• SMAC promotes CASP9 activation by binding to IAPs and removing their inhibitory activity.
• The inhibitor of apoptosis proteins (IAPs) regulate programmed cell death by inhibiting members of the caspase family of enzymes.
• Smac/DIABLO is a mitochondrial protein that is released along with cytochrome c during apoptosis and activates cytochrome c/Apaf-1/caspase-9 pathway.
• Smac is an antagonist of the X-linked inhibitor of apoptosis (XIAP) - the most potent caspase inhibitor of all known inhibitor of apoptosis-family members.
• Smac promotes apoptosis by eliminating the inhibitory effect of inhibitor-of-apoptosis (IAPs) through physical interactions.
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• AA Sequence:MAALKSWLSRSVTSFFRYRQCLCVPVVANFKKRCFSELIRPWHKTVTIGFGVTLCAVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED
• Storage and Stability:May be stored at 4°C for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20°C.
• Aliquots are stable for at least 12 months.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.