SLAP also known as Src-like-adapter protein 1 is a 276aa containing adapter protein, functioning as a negative regulator of T-cell receptor (TCR) signaling.
SLAP belonging to the SRC family of cytoplasmic tyrosine kinases contains a SH2 domain and a SH3 domain.
This cytoplasmic protein colocalizes with endosomes and is known to inhibit T-cell antigen-receptor induced activation of nuclear factor of activated T-cells.
It acts as a negative regulator of positive selection and mitosis of T-cells.
SLAP may act by linking signaling proteins such as ZAP70 with CBL, leading to a CBL dependent degradation of signaling proteins.
Expression of SLAP is weak in heart, adult brain, placenta, liver, skeletal muscle, kidney and pancreas but is high in lung and fetal brain.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MGNSMKSTPAPAERPLPNPEGLDSDFLAVLSDYPSPDISPPIFRRGEKLRVISDEGGWWKAISLSTGRESYIPGICVARVYHGWLFEGLGRDKAEELLQLPDTKVGSFMIRESETKKGFYSLSVRHRQVKHYRIFRLPNNWYYISPRLTFQCLEDLVNHYSEVADGLCCVLTTPCLTQSTAAPAVRASSSPVTLRQKTVDWRRVSRLQEDPEGTENPLGVDESLFSYGLRESIASYLSLTSEDNTSFDRKKKSISLMYGGSKRKSSFFSSPPYFED
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for at least 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：50ug
Host：mouse
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by Protein A affinity chromatography.
Form：Supplied as a liquid in PBS, pH 7.2.
Specificity：Recognizes human SLA.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu
Immunogen：Full length human SLA, aa1-276 (NP_006739.1).
