84-1393-84 SKP1 (S-phase Kinase-associated Protein 1, Cyclin-A/CDK2-associated Protein p19, Organ of Corti Protein 2, OCP-2, Organ of Corti Protein II, OCP-II, RNA Polymerase II Elongation Factor-like Protein, SIII, Transcription Elongation Factor B, p19A, p19skp1, EMC19, OCP2, SKP1A, TCEB1L, MGC34403) 100ug 133380
84-1393-84 SKP1 (S-phase Kinase-associated Protein 1, Cyclin-A/CDK2-associated Protein p19, Organ of Corti Protein 2, OCP-2, Organ of Corti Protein II, OCP-II, RNA Polymerase II Elongation Factor-like Protein, SIII, Transcription Elongation Factor B, p19A, p19skp1, EMC19, OCP2, SKP1A, TCEB1L, MGC34403) 100ug 133380
S-phase kinase-associated protein 1A (Skp1) is a component of the SCF ubiquitin ligase complex, which mediates the ubiquitination of proteins involved in cell cycle progression, signal transduction and transcription.
Skp1 interacts directly with cullin 1 and F-box proteins in the SCF complex.
It is also involved in the control of beta-catenin levels and the activity of beta-catenin dependent TCF transcription factors.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVGSTQFCL
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for at least 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by Protein A affinity chromatography.
Form：Supplied as a liquid in PBS, pH 7.2.
Specificity：Recognizes human SKP1.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu
Immunogen：Full length human SKP1, aa1-160 (NP_008861.2).
