SAA4 is a constitutively expressed protein belonging to the SAA family.
It is a major acute phase reactant and an apolipoprotein of the HDL complex.
SAA4 is constitutively expressed only in humans and mice, is associated almost entirely with lipoproteins of the high density range.
Its physiological function is unknown and its serum concentration has no relationship with those of other major apolipoproteins.
The presence of SAA4 mRNA and protein in macrophage derived foam cells of coronary and carotid arteries suggested a specific role of human SAA4 during inflammation including atherosclerosis.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MRLFTGIVFCSLVMGVTSESWRSFFKEALQGVGDMGRAYWDIMISNHQNSNRYLYARGNYDAAQRGPGGVWAAKLISRSRVYLQGLIDYYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRFRPDGLPKKY
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for at least 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:100ug
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2.
Specificity:Recognizes human SAA4.
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu
Immunogen:Full length human SAA4, aa1-130 (NP_006503.1).