S100 Calcium Binding Protein A9, also known as Calgranulin B, belongs to the S100 family containing EF-hand type Ca2+-binding proteins.
It is involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation, and associated with the disease cystic fibrosis.
S100A9 has been implicated in the abnormal differentiation of myeloid cells in the stroma of cancer.
This protein may function in the inhibition of casein kinase.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for at least 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by Protein A affinity chromatography.
Form：Supplied as a liquid in PBS, pH 7.2.
Specificity：Recognizes human S100A9.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu
Immunogen：Full length human S100A9, aa1-114 (NP_002956.1).
