RUNX3, also called CBFA3, AML-2 or PEBP2-aC, is a member of the Runt domain family of nuclear transcriptional regulators.
All of the RUNX proteins form dimers with CBF-b.
The runt domain (aa54-186) is required for DNA binding, while a Pro/Ser/Thr-rich region (aa191-415) transcriptionally activates target genes.
Isoform 2 has an alternate 19aa sequence in place of the N-terminal 5aa of isoform 1.
The 415aa human RUNX3 shows 91% aa identity with mouse or rat RUNX3.
RUNX3 is necessary for growth control of gastric epithelium, neurogenesis of dorsal root ganglia, and T cell differentiation.
RUNX3 expression is frequently mutated in tumors and appears to be silenced by methylation.
Applications:Suitable for use in Immunofluorescence, Immunohistochemistry and Western Blot.
Other applications not tested.
Recommended Dilution:Immunofluorescence: 10ug/mlImmunohistochemistry (Formalin fixed paraffin embedded): 3ug/mlOptimal dilutions to be determined by the researcher.
AA Sequence:MASNSIFDSFPTYSPTFIRDPSTSRRFTPPSPAFPCGGGGGKMGENSGALSAQAAVGPGGRARPEVRSMVDVLADHAGELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGDVPDGTVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPTQVATYHRAIKVTVDGPREPRRHRQKLEDQTKPFPDRFGDLERLRMRVTPSTPSPRGSLSTTSHFSSQPQTPIQGTSELNPFSDPRQFDRSFPTLPTLTESRFPDPRMHYPGAMSAAFPYSATPSGTSISSLSVAGMPATSRFHHTYLPPPYPGAPQNQSGPFQANPSPYHLYYGTSSGSYQFSMVAGSSSGGDRSPTRMLASCTSSAASVAAGNLMNPSLGGQSDGVEADGSHSNSPTALSTPGRMDEAVWRPY
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for at least 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:50ug
Host:mouse
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2.
Specificity:Recognizes human RUNX3.
Isotype:IgG
Calc Applications Abbrev:IF IHC WB
Calc Crossreactivity:Hu
Immunogen:Full length human RUNX3, aa1-429 (AAH13362.1).