84-1391-01 RTN3 (Reticulon-3, Neuroendocrine-specific Protein-like 2, NSP-like Protein 2, Neuroendocrine-specific Protein-like II, NSP-like Protein II, NSPLII, ASYIP, NSPL2) 50ug 132879
84-1391-01 RTN3 (Reticulon-3, Neuroendocrine-specific Protein-like 2, NSP-like Protein 2, Neuroendocrine-specific Protein-like II, NSP-like Protein II, NSPLII, ASYIP, NSPL2) 50ug 132879
May be involved in membrane trafficking in the early secretory pathway.
Inhibits BACE1 activity and amyloid precursor protein processing.
May induce caspase-8 cascade and apoptosis.
May favor BCL2 translocation to the mitochondria upon endoplasmic reticulum stress.
In case of enteroviruses infection, RTN3 may be involved in the viral replication or pathogenesis.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAVHDLIFWRDVKKTGFVFGTTLIMLLSLAAFSVISVVSYLILALLSVTISFRIYKSVIQAVQKSEEGHPFKAYLDVDITLSSEAFHNYMNAAMVHINRALKLIIRLFLVEDLVDSLKLAVFMWLMTYVGAVFNGITLLILAELLIFSVPIVYEKYKTQIDHYVGIARDQTKSIVEKIQAKLPGIAKKKAE
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for at least 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：50ug
Host：mouse
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by Protein A affinity chromatography.
Form：Supplied as a liquid in PBS, pH 7.2.
Specificity：Recognizes human RTN3.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu
Immunogen：Full-length human RTN3, aa1-236 (NP_006045.1).
