REG3A, also known as Regenerating islet-derived protein 3 alpha, Reg III-alpha, and pancreatitis associated protein, is a 174aa containing stress protein involved in the control of bacterial proliferation.
This secreted protein is generally found in the apical region of pancreatic acinar cells and appears in pancreatic juice after induction of pancreatic inflammation.
It has a possible role in inducing new pancreatic islets development.
REG3A belongs to the Reg-related family with a C-type lectin domain and is constitutively expressed in intestine while low expression is found in healthy pancreas.
Overexpression of REG3A is seen during the acute phase of pancreatitis and in some patients with chronic pancreatitis.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MLPPMALPSVSWMLLSCLMLLSQVQGEEPQRELPSARIRCPKGSKAYGSHCYALFLSPKSWTDADLACQKRPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTISSPGHCASLSRSTAFLRWKDYNCNVRLPYVCKFTD
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for at least 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:100ug
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2.
Specificity:Recognizes human REG3A.
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu
Immunogen:Full length human REG3A, aa1-175 (NP_002571.1).