84-1388-39　RBCK1 (C20orf18, RNF54, UBCE7IP3, XAP3, XAP4, RanBP-type and C3HC4-type Zinc Finger-containing Protein 1, HBV-associated Factor 4, Heme-oxidized IRP2 Ubiquitin Ligase 1, Hepatitis B Virus X-associated Protein 4, RING Finger Protein 54, Ubiquitin-conjugating Enzyme 7-interacting Protein 3) 100ul　132374

特徴

• The protein encoded by this gene is similar to mouse UIP28/UbcM4 interacting protein.
• Alternative splicing has been observed at this locus, resulting in distinct isoforms.
• [provided by RefSeq].
• Applications:Suitable for use in Western Blot and Immunoprecipitation.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• AA Sequence:MGTATPDGREDQERLWVSVEDAQMHTVTIWLTVRPDMTVASLKDMVFLDYGFPPVLQQWVIGQRLARDQETLHSHGVRQNGDSAYLYLLSARNTSLNPQELQRERQLRMLEDLGFKDLTLQPRGPLEPGPPKPGVPQEPGRGQPDAVPEPPPVGWQCPGCTFINKPTRPGCEMCCRARPEAYQVPASYQPDEEERARLAGEEEALRQYQQGVPAGHHPQQPGGGGLLPLH
• Storage and Stability:May be stored at 4°C for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20°C.
• Aliquots are stable for at least 12 months.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.