RARRES3 also called Tig3 or RIG1 is an 18kD, 164aa cytoplasmic protein within the LRAT family of growth inhibitory proteins, which are class II tumor-suppressors.
RARRES3 is expressed in a variety of cells including epidermal keratinocytes, and may be downregulated in tumor cells and cell lines.
It shows phospholipase activity and interaction with type I transglutaminase.
A C-terminal hydrophobic region allows perinuclear localization.
RARRES3 is not structurally related to other RARRES genes.
A canine ortholog shares 72% aa identity within the region used as an immunogen; orthologs are unlikely in rodents.
Applications:Suitable for use in Western Blot and Immunofluorescence.
Other applications not tested.
Recommended Dilution:Immunofluorescence: 10ug/mlOptimal dilutions to be determined by the researcher.
AA Sequence:MASPHQEPKPGDLIEIFRLGYEHWALYIGDGYVIHLAPPSEYPGAGSSSVFSVLSNSAEVKRERLEDVVGGCCYRVNNSLDHEYQPRPVEVIISSAKEMVGQKMKYSIVSRNCEHFVTQLRYGKSRCKQVEKAKVEVGVATALGILVVAGCSFAIRRYQKKATA
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for at least 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：50ug
Host：mouse
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by Protein A affinity chromatography.
Form：Supplied as a liquid in PBS, pH 7.2.
Specificity：Recognizes human RARRES3.
Isotype：IgG
Calc Applications Abbrev：IF WB
Calc Crossreactivity：Hu
Immunogen：Full length human RARRES3, aa1-164 (AAH09678.1).
