PTGES is a glutathione-dependent prostaglandin E synthase.
The expression of it has been shown to be induced by proinflammatory cytokine interleukin 1 beta (IL1B).
Its expression can also be induced by tumor suppressor protein TP53, and may be involved in TP53 induced apoptosis.
Knockout studies in mice suggest that it may contribute to the pathogenesis of collagen-induced arthritis and mediate acute pain during inflammatory responses.
Applications:Suitable for use in Immunofluorescence and Western Blot.
Other applications not tested.
Recommended Dilution:Immunofluorescence: 10ug/mlOptimal dilutions to be determined by the researcher.
AA Sequence:MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:50ug
Host:mouse
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2.
Specificity:Recognizes human PTGES.
Isotype:IgG
Calc Applications Abbrev:IF WB
Calc Crossreactivity:Hu Mo
Immunogen:Full length human PTGES, aa1-152 (NP_004869.1).