DARPP-32, a dopamine (DA) and cAMP-regulated ~32kD phosphoprotein that is associated with dopaminoceptive neurons bearing D-1 receptors in the basal ganglia.
The protein inhibits protein phosphatase I when it is phosphorylated on Thr34.
In contrast, when DARPP-32 is phosphorylated on Thr75 the protein acts as an inhibitor of PKA.
Phosphorylation of DARPP-32 is thought to play a critical role in the regulation of dopaminergic neurotransmission.
In addition, the activity of DARPP-32 is also thought to play important roles in the actions of alcohol, caffeine and Prozac®.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MDPKDRKKIQFSVPAPPSQLDPRQVEMIRRRRPTPAMLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDELGELRELGYPREEDEEEEEDDEEEEEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDGGSEDQVEDPALSEPGEEPQRPSPSEPGT
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for at least 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:50ug
Host:mouse
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2.
Specificity:Recognizes human PPP1R1B.
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu
Immunogen:Full length human PPP1R1B, aa1-204 (NP_115568.2).