84-1383-78　POLR3K (DNA-directed RNA Polymerase III Subunit RPC10, RNA Polymerase III Subunit C10, DNA-directed RNA Polymerase III Subunit K, RNA Polymerase III 12.5kD Subunit, RPC12.5, RNA Polymerase III Subunit C11, HsC11p, RPC11, hRPC11, My010, C11-RNP3, RPC12.5) 100ug　131601

特徴

• DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.
• Component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs.
• Plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses.
• Acts as nuclear and cytosolic DNA sensor involved in innate immune response.
• Can sense non-self dsDNA that serves as template for transcription into dsRNA.
• The non-self RNA polymerase III transcripts, such as Epstein-Barr virus-encoded RNAs (EBERs) induce type I interferon and NF- Kappa-B through the RIG-I pathway.
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• AA Sequence:MLLFCPGCGNGLIVEEGQRCHRFACNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWENVDSTAESCPKCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD
• Storage and Stability:May be stored at 4°C for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20°C.
• Aliquots are stable for at least 12 months.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.