84-1383-72 POLR2L (DNA-directed RNA Polymerases I, II, and III Subunit RPABC5, RNA Polymerases I, II, and III Subunit ABC5, DNA-directed RNA Polymerase III Subunit L, RNA Polymerase II 7.6kD Subunit, RPB7.6, RPB10 Homolog) 100ug 131593
84-1383-72 POLR2L (DNA-directed RNA Polymerases I, II, and III Subunit RPABC5, RNA Polymerases I, II, and III Subunit ABC5, DNA-directed RNA Polymerase III Subunit L, RNA Polymerase II 7.6kD Subunit, RPB7.6, RPB10 Homolog) 100ug 131593
DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.
Common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and a small RNAs, such as 5S rRNA and tRNAs, respectively.
Pol II is the central component of the basal RNA polymerase II transcription machinery.
Pols are composed of mobile elements that move relative to each other.
In Pol II, POLR2L/RBP10 is part of the core element with the central large cleft.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPLEK
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for at least 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by Protein A affinity chromatography.
Form：Supplied as a liquid in PBS, pH 7.2.
Specificity：Recognizes human POLR2L.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu
Immunogen：Full length human POLR2L, aa1-422 (NP_066951.1).
