84-1383-71 POLR2H (DNA-directed RNA Polymerases I, II, and III Subunit RPABC3, DNA-directed RNA Polymerase II Subunit H, DNA-directed RNA Polymerases I, II, and III 17.1kD Polypeptide, RPB17, RPB8 Homolog) 100ul 131588
84-1383-71 POLR2H (DNA-directed RNA Polymerases I, II, and III Subunit RPABC3, DNA-directed RNA Polymerase II Subunit H, DNA-directed RNA Polymerases I, II, and III 17.1kD Polypeptide, RPB17, RPB8 Homolog) 100ul 131588
This gene encodes one of the essential subunits of RNA polymerase II that is shared by the other two eukaryotic DNA-directed RNA polymerases, I and III.
Applications:Suitable for use in Immunoprecipitation.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLAF
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for at least 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：100ul
Host：rabbit
Source Antibody：human
Grade：Serum
Purity：Serum
Form：Supplied as a liquid.
Specificity：Recognizes human POLR2H.
Isotype：IgG
Calc Applications Abbrev：IP
Calc Crossreactivity：Hu
Immunogen：Full length human POLR2H, aa1-150 (NP_006223.2).
