PLA2G16 (Group 16 phospholipase A2; also HREV107 and AdPLA) is a Ca++-dependent 17-18kD member of the H-rev107 family of molecules.
It is expressed intracellularly by white adipocytes, induced by insulin, and generates arachadonic acid from phospholipids.
The arachadonic acid is converted to PGE2, which binds the EP3 receptor and decreases cAMP levels.
This results in decreased hormone-sensitive lipase activity and increased adiposity.
Human PLA216 is 16211aa in length.
It is associated with both membranes and cytosol, and may possess a transmembrane segment between aa134-154.
The enzymatic activity resides in His23 and Cys113.
There is one potential isoform that shows a 20aa substitution for the first four amino acids.
Over aa12-132, human PLA2G16 shares 88% aa identity with mouse PLA2G16.
Applications:Suitable for use in Western Blot and Immunoprecipitation.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MRAPIPEPKPGDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIVKKELLYDVAGSDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQVRDVIIAASVAGMGLAAMSLIGVMFSRNKRQKQ
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for at least 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：100ul
Host：rabbit
Source Antibody：human
Grade：Serum
Purity：Serum
Form：Supplied as a liquid.
Specificity：Recognizes human PLA2G16.
Isotype：IgG
Calc Applications Abbrev：IP WB
Calc Crossreactivity：Hu
Immunogen：Full length human PLA2G16, aa1-162 (AAH01387.1).
