PIN4, also known as Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4, is peptidyl-prolyl cis/trans isomerase (PPIase) that interacts with NIMA and is essential for cell cycle regulation.
There are two different isoforms which are PAR14 and PAR17.
PIN4/PAR17 was imported into mitochondria in a time and membrane potential-dependent manner, where it reached the mitochondrial matrix.
Moreover, Pin4 protein was shown to bind to double-stranded DNA under physiological salt conditions.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MPMAGLLKGLVRQLERFSVQQQASKMPPKGKSGSGKAGKGGAASGSDSADKKAQGPKGGGNAVKVRHILCEKHGKIMEAMEKLKSGMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for at least 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by Protein A affinity chromatography.
Form：Supplied as a liquid in PBS, pH 7.2.
Specificity：Recognizes human PIN4.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu
Immunogen：Full length human PIN4, aa1-156 (NP_006214.2).
