PDX1, also known as Pancreas/duodenum homeobox protein 1, is a nuclear protein belonging to the Antp homeobox family and IPF1/XlHbox-8 subfamily with a homeobox DNA-binding domain.
It activates insulin, somatostatin, glucokinase, islet amyloid polypeptide and glucose transporter type 2 gene transcription and is particularly involved in glucose-dependent regulation of insulin gene transcription.
During development, PDX1 specifies the early pancreatic epithelium, permitting its proliferation, branching and subsequent differentiation.
Expression is common in duodenum and pancreas (Langerhans islet beta cells and small subsets of endocrine non-beta-cells, at low levels in acinar cells).
Defects in PDX1 are associated with pancreatic agenesis, maturity onset diabetes noninsulin-dependent diabetes mellitus (NIDDM), also known as diabetes mellitus type II, and maturity onset diabetes of the young type 4 (MODY4).
Applications:Suitable for use in Immunofluorescence and Western Blot.
Other applications not tested.
Recommended Dilution:Immunofluorescence: 10ug/mlOptimal dilutions to be determined by the researcher.
AA Sequence:MAASWRLGCDPRLLRYLVGFPGRRSVGLVKGALGWSVSRGANWRWFHSTQWLRGDPIKILMPSLSPTMEEGNIVKWLKKEGEAVSAGDALCEIETDKAVVTLDASDDGILAKIVVEEGSKNIRLGSLIGLIVEEGEDWKHVEIPKDVGPPPPVSKPSEPRPSPEPQISIPVKKEHIPGTLRFRLSPAARNILEKHSLDASQGTATGPRGIFTKEDALKLVQLKQTGKITESRPTPAPTATPTAPSPLQATAGPSYPRPVIPPVSTPGQPNAVGTFTEIPASNIRRVIAKRLTESKSTVPHAYATADCDLGAVLKVRQDLVKDDIKVSVNDFIIKAAAVTLKQMPDVNVSWDGEGPKQLPFIDISVAVATVKGLLTPIIKDAAAKGIQEIADSVKALSKKARDGKLLPEEYQGGSFSISNLGMFGIDEFTAVINPPQACILAVGRFRPVLKLTEDEEGNAKLQQRQLITVTMSSDSRVVDDELATRFLKSFKANLENPIRLA
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:50ug
Host:mouse
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2.
Specificity:Recognizes human PDHX.
Isotype:IgG
Calc Applications Abbrev:IF WB
Calc Crossreactivity:Hu
Immunogen:Full length human PDHX, aa1-501 (AAH10389.1).