84-1379-97　PCBD2 (Pterin-4-alpha-carbinolamine Dehydratase 2, PHS 2, 4-alpha-hydroxy-tetrahydropterin Dehydratase 2, DcoH-like Protein DCoHm, Dimerization Cofactor of Hepatocyte Nuclear Factor 1 from Muscle, HNF-1-alpha Dimerization Cofactor, DCOH2, DCOHM) 50ug　130927

特徴

• PCBD2 belongs to the pterin-4-alpha-carbinolamine dehydratase family.
• It is involved in tetrahydrobiopterin biosynthesis.
• It both prevents the formation of 7-pterins and accelerates the formation of quinonoid-BH2.
• PCBD2 regulates the dimerization of homeodomain protein HNF-1-alpha and enhances its transcriptional activity.
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• AA Sequence:MAAVLGALGATRRLLAALRGQSLGLAAMSSGTHRLTAEERNQAILDLKAAGWSELSERDAIYKEFSFHNFNQAFGFMSRVALQAEKMNHHPEWFNVYNVQITLTSHDCGELTKKDVKLAKFIEKAAASV
• Storage and Stability:May be stored at 4°C for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20°C.
• Aliquots are stable for at least 12 months.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.